top of page

TB-500 5mg

£15.99Price

10% Discount

TB-500 5mg – Premium Research Peptide 


TB-500, supplied in a 5mg dosage, is a high-grade research peptide developed for advanced scientific studies focused on cellular regeneration and tissue repair mechanisms. It is intended for use in controlled laboratory environments where precision, consistency, and reliability are essential. 


Product Details: 

Name: TB-500 5mg Catalogue Number: GP-TB500-5 Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S Molecular Weight: 4963.4 g/mol Purity: ≥98% Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Form: Lyophilised powder 


Usage and Storage: 

TB-500 is supplied as a lyophilised powder to ensure maximum stability and ease of handling in research settings. For best results, refer to the detailed reconstitution and storage guidelines available on our website. 


Synthesis and Quality Control: 

This peptide is produced through tightly controlled synthesis processes to ensure high purity (≥98%) and consistent quality. Each batch undergoes comprehensive analytical testing and quality assurance checks to confirm suitability for scientific research applications. 


Legal and Safety Notice: 

Peptide Lab UK supplies TB-500 strictly for scientific and laboratory research purposes only. We are committed to maintaining high standards of quality and compliance in support of the research community. 

TB-500 and all related compounds are not intended for human consumption, medical treatment, or clinical use. 


Usage Instructions 


Important: Peptide Lab UK products are sold strictly for research purposes only. Any inquiry relating to human consumption is strictly prohibited. 

    692165bb-fbdd-4f83-bf82-433ded9f2cab_edited.jpg

    Research-grade peptides and related research substances intended strictly for laboratory use only. Valued internationally for dependable standards, high purity, and reliable performance.

    Unit 12 Keighley Storage Brewery Street Keighley BD21 England

    Disclaimer

    By purchasing from Peptides Lab UK, you acknowledge and agree to the following terms: 

    Research Use Only: All products are supplied strictly for laboratory and research purposes. They are not intended for human consumption, medical, therapeutic, diagnostic, or clinical use. 

    Non-Medical Products: Products available on this website are not classified as medicinal products and must not be represented or used as such. 

    Buyer Responsibility: It is the purchaser’s responsibility to ensure full compliance with all applicable laws and regulations within their jurisdiction. Peptides Lab UK accepts no liability for improper use or any consequences arising from misuse. 

    Returns Policy: Due to the sensitive nature of these products, all sales are final and returns are not accepted. 

    By completing a purchase, you confirm that you have read, understood, and agreed to these terms

    bottom of page