TB500 10mg
10% Discount
TB-500 10mg – Premium Research Peptide
TB-500, supplied in a 10mg dosage, is a high-grade research peptide developed for advanced scientific studies focused on cellular regeneration and tissue repair mechanisms. It is intended for use in controlled laboratory environments where precision, consistency, and reliability are essential.
Product Details:
Name: TB-500 10mg Catalogue Number: GP-TB500-10 Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S Molecular Weight: 4963.4 g/mol Purity: ≥98% Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Form: Lyophilised powder
Usage and Storage:
TB-500 is supplied as a lyophilised powder to ensure maximum stability and ease of handling in research settings. For best results, refer to the detailed reconstitution and storage guidelines available on our website.
Synthesis and Quality Control:
This peptide is produced through tightly controlled synthesis processes to ensure high purity (≥98%) and consistent quality. Each batch undergoes comprehensive analytical testing and quality assurance checks to confirm suitability for scientific research applications.
Legal and Safety Notice:
Peptide Lab UK supplies TB-500 strictly for scientific and laboratory research purposes only. We are committed to maintaining high standards of quality and compliance in support of the research community.
TB-500 and all related compounds are not intended for human consumption, medical treatment, or clinical use.
Usage Instructions
Important: Peptide Lab UK products are sold strictly for research purposes only. Any inquiry relating to human consumption is strictly prohibited.
















